PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0063s0098.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family ZF-HD
Protein Properties Length: 237aa    MW: 25763.6 Da    PI: 8.6608
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0063s0098.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.67.3e-3451106359
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                           ++Y+eClkNhAas+Ggha+DGCgEfmps geegt +alkCaAC+CHRnFHRreve 
  Mapoly0063s0098.1.p  51 IIKYRECLKNHAASIGGHAIDGCGEFMPS-GEEGTLDALKCAACECHRNFHRREVEG 106
                          579*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2444112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.9E-3152104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-3153104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.36754103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.5E-31159234IPR009057Homeodomain-like
SuperFamilySSF466896.45E-18161234IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-27173229IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MDLGAHEGDL QMPMSGGYAG HHESSKMKLL TSGNGTGMED IRPLESKAKK IIKYRECLKN  60
HAASIGGHAI DGCGEFMPSG EEGTLDALKC AACECHRNFH RREVEGEPSC DCHHVRKERK  120
RGTPGAMPHT PLALPATTVI ARPPAPMIMA LNTVPTDSDD QDGGVGGPAS AMKKRFRTKF  180
SAEQKEKMCS FADKLGWKIQ KHDEAAVQAF CADIGVKRHV LKVWMHNNKH TLGKKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-261742311875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912718.12e-81PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_010912719.12e-81PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_010912720.12e-81PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ6YXH58e-66ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A0D6R1Q92e-99A0A0D6R1Q9_ARACU; Uncharacterized protein
STRINGPP1S165_109V6.13e-91(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-63homeobox protein 22